Source:
Generated By: https://synbiohub.org/public/igem/igem2sbol/1
Created by: Larissa Kr??ger
Date created: 2016-10-12 11:00:00
Date modified: 2016-10-17 02:45:40
TorA-BtuF
| Types | DnaRegion |
| Roles | engineered_region Composite |
| Sequences | BBa_K1978000_sequence (Version 1) |
Description
The TorA-BtuF Biobrick consists of a TorA signal linked to BtuF, which is a vitamin B12 binding protein. The TorA signal sequence allows export of fully-folded proteins through the inner membrane via the TAT(Twin-Arginin)export system. This enables export of vitamin B12 out of the cell.The TorA sequence codes for a peptide that harbours a twin-arginine motif. This is vital for the recognition by the Tat system. Moreover, an AxA motif is present, which leads to cleavage by the leader peptidase I (Palmer & Berks 2012).
MNNNDLFQASRRRFLAQLGGLTVAGMLGPSLLTPRRATA
BtuF is the periplasmic binding protein relevant for uptake of vitamin B12 through the outer membrane that is associated with the ABC transporter BtuCD (Kandt et al., 2006). BtuF is the periplasmic binding protein. It has a size of 30.19 kDa and is composed of two globular domains, between which vitamin B12 is bound, linked by a rigid interdomain α-helix (Karpowich et al., 2003).
The TorA signal sequence and the sequence for BtuF are connected by a long linker.