Types | DnaRegion
|
Roles | engineered_region
Signalling
|
Sequences | BBa_K1978002_sequence (Version 1)
|
Description
The TorA-RFP Biobrick consists of a TorA signal linked to RFP, which is fluorescent protein. The TorA signal sequence allows export of fully-folded proteins through the inner membrane via the TAT(Twin-Arginin)export system. This enables export of RFP out of the cell. The TorA sequence codes for a peptide that harbours a twin-arginine motif. This is vital for the recognition by the Tat system. Moreover, an AxA motif is present, which leads to cleavage by the leader peptidase I (Palmer & Berks 2012).
MNNNDLFQASRRRFLAQLGGLTVAGMLGPSLLTPRRATA
Notes
The design of the linker was crucial, as well as, the codon optimization of TorA.
Source
TorA was synthesized by IDT but the basic amino acid sequence comes from E. coli. The RFP used stems from another iGEM vector.