| Types | DnaRegion
|
| Roles | Coding
CDS
|
| Sequences | BBa_K417001_sequence (Version 1)
|
Description
This is the protein coding sequence of 1-aminocyclopropane-1-carboxylate synthase, which catalyses the formation of 1-aminocyclopropane-1-carboxylate and methylthioadenosine from S-adenosyl methionine (AdoMet).
(S-adenosyl-L-methionine <=> 1-aminocyclopropane-1-carboxylate + methylthioadenosine).
This enzyme is commonly referred to as ACC synthase.
Notes
Removal of the C-terminal amino acids. According to White, M. F., Vasquez, J., Yang, S. F., & Kirsch, J. F. (1994). PNAS, 91(26), 12428-32. (http://www.ncbi.nlm.nih.gov/pubmed/7809054) - this truncation has been reported to have no effect on specific activity.
Source
Malus domestica (Apple), codon optimized for E. coli, with the C-terminal amino acids -YYNVPEVNGGSQSSHLSHSRRQSLTKWVSRLSFDDRGPIPGR* removed