Source:
Generated By: https://synbiohub.org/public/igem/igem2sbol/1
Created by: Taylor Marie Chavez, Maria Iglesias, Alison Jahansouz
Date created: 2015-10-22 11:00:00
Date modified: 2015-12-04 06:52:56
mRNA Sequence for Poly-beta-Hydroxybutyrate Polymerase
| Types | DnaRegion |
| Roles | Coding CDS |
| Sequences | BBa_M36660_sequence (Version 1) |
Description
Part codes for the mRNA sequence to produce poly-beta-hydroxybutyrate polymerase, which synthesizes poly-3-hydroxybutyrate in the presence of glucose. Poly-3-hydroxybutyrate, or P3HB, is a biodegradable polymer which will break down after it has fulfilled its intended use. Part is intended to be inserted into pD431-SR, with a high copy number and kanamycin resistance. Complete system should be transformed into E. Coli.Amino Acid sequence is as follows: MKGPLGFSAEDLMQETLSMQRKLREGLKLLPGVEDVDYGVTERQEVWRDGKVVLYRFVGDAAPVARTPLLIVYALVNRPYMVDLQADRSLVKGLLGHGQDVYVLDWGYPDRSERYLTLEDYLLRYIDGAVDHLRAASGLEAVDVLGICQGGTFALCYAALERAKIRNLITMVTPVDFHTPDNMLSNWARMVDVDLFVDTMGNVPADLMNASYLMLKPFRLNLQKYVGLLDILDDKQALEDFLRMEKWIFDSPDLAGEAFREFVTQFYQRNGLVTGDVRIGGQAVDLHAVDMPVLNIYAEHDHLVPPDASRALRGLVGSEDYTELSFRGGHIGIYVSGRAQREVPVAIHRWLQARGGNG*
Notes
Part was designed to meet the following conditions: be less than 1500 bp, avoid BbsI, BsaI, and BsmBI, and have less than five repeats 10 bp. There was an active attempt to avoid the restriction sites, stated above, that DNA 2.0 uses in the synthesis of DNA and to minimize repeats in the sequence to ensure success during synthesis. A limit of 1500 bp was imposed by the course.Source
Part comes from the genomic sequence of Xanthomonas campestris pv. raphani 756C, specifically G0CFI5.Referenced http://www.uniprot.org/uniprot/G0CFI5 and http://www.google.com/patents/WO1995020621A1?cl=en, which both contributed to the discovery of the gene sequence for the necessary protein.